PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_08517A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 231aa    MW: 26706.5 Da    PI: 9.397
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_08517AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171057148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg+WT++Ed +lv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
  Oropetium_20150105_08517A 10 RGPWTEQEDMQLVCTVRLFGDRRWDFIAQVSGLNRTGKSCRLRWVNYL 57
                               89********************************************97 PP

2Myb_DNA-binding55.91e-1764108248
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                gr++++E+ l++d+++++G++ W++Iar+++ gRt++++k++w++++
  Oropetium_20150105_08517A  64 GRMSPQEERLIIDLHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 108
                                89*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.691557IPR017930Myb domain
SuperFamilySSF466891.98E-297104IPR009057Homeodomain-like
SMARTSM007171.1E-14959IPR001005SANT/Myb domain
PfamPF002493.6E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-191164IPR009057Homeodomain-like
CDDcd001677.03E-111257No hitNo description
PROSITE profilePS5129425.82658112IPR017930Myb domain
SMARTSM007172.5E-1662110IPR001005SANT/Myb domain
PfamPF002491.3E-1564107IPR001005SANT/Myb domain
CDDcd001676.20E-1265108No hitNo description
Gene3DG3DSA:1.10.10.607.9E-2465111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MVTVRQEMRR GPWTEQEDMQ LVCTVRLFGD RRWDFIAQVS GLNRTGKSCR LRWVNYLHPG  60
LKHGRMSPQE ERLIIDLHAR WGNRWSRIAR RLPGRTDNEI KNYWRTHMRK KAQERKMRMS  120
PSSSSSSLTY QSCLLDATPG TGMVHGNARN GSGGIMSTLE SVQSTMDGYP MDQIWKEIES  180
PALLGIDEPI EKAYGGLPNT LPTTAMWDYK CPEVFWKMED DEIRMFDYGK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-2871121105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980031.11e-132PREDICTED: myb-related protein MYBAS1-like
SwissprotQ53NK61e-118MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLK3ZJP91e-132K3ZJP9_SETIT; Uncharacterized protein
STRINGSi026803m1e-131(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.31e-73myb domain protein 59